/

Protein Molecular Weight Calculator — From Sequence or Formula

SA
Shahid Ali
Lead Developer · CECOS University of IT and Emerging Sciences · ORCID: 0009-0008-5995-4438
Fact-Checked DOI Archived Last verified: August 2026
🧬 Biochemistry Calculator

Protein Molecular Weight Calculator

Paste any amino acid sequence to instantly calculate protein molecular weight — average mass, monoisotopic mass for mass spectrometry, kDa, amino acid composition, and the molar extinction coefficient (ε280). Works as a protein MW calculator, peptide molecular weight calculator, or protein dalton calculator for sequences of any length.

⚗️ Protein / Peptide Molecular Weight Calculator
Non-amino-acid characters, numbers, and whitespace are stripped automatically. Unknown residues are flagged after calculation.
Insulin B-chain (30 aa)
GFP (239 aa)
ACTH 1-10 (10 aa)
⚠️Error

Average Protein Molecular Weight

0.00 kDa

0 Da

Monoisotopic MW
0 Da
for mass spectrometry
Sequence Length
0
residues
ε280 (M⁻¹cm⁻¹)
0
extinction coeff.
A280 @ 1 mg/mL
0.000
estimated absorbance
Amino Acid Composition
Hydrophobic
Polar
Positive (basic)
Negative (acidic)
Extinction Coefficient Breakdown (Pace method)
Tryptophan (W) × 5,5000
Tyrosine (Y) × 1,4900
Cysteine (C) × 1250
Total ε2800 M⁻¹cm⁻¹
📐 Step-by-Step Calculation ▾
Molecular weight is calculated from the unmodified primary amino acid sequence. Post-translational modifications, disulfide bonds, signal peptide cleavage, and bound cofactors are not included. For mass spectrometry work, verify against the monoisotopic mass shown above.
⇄ kDa / Da / MDa Converter + SDS-PAGE Reference
Da
35,000
kDa
35.00
MDa
0.035
amino acids
≈ 33,000 Da (33.00 kDa)

The 110 Da/residue rule is a rough estimate. For accurate protein molecular weight, use the sequence-based calculator above.

Visual reference only — actual SDS-PAGE migration depends on gel percentage, protein shape, and glycosylation, not molecular weight alone.

🧪 Protein Concentration Calculator (Beer-Lambert)

Uses A = ε × c × l. Auto-fills ε280 and MW from Tool 1 if you've already calculated a sequence above — or enter values manually.

mg/mL
0.000
µM
0.00
µg/µL
0.000

Molar concentration: 0 M

How to Calculate Protein Molecular Weight from Sequence

Calculating protein molecular weight from a sequence is a straightforward summation problem: add up the average residue mass of every amino acid in the chain, then add the mass of one water molecule (18.011 Da) to account for the free H at the N-terminus and OH at the C-terminus. This is exactly how the protein molecular weight calculator above works — it is not an estimate, it is an exact sum based on the primary sequence.

There are two types of mass used in protein chemistry, and knowing which one to use matters. Average mass uses the natural isotopic-abundance-weighted mass of each element and is the correct choice for nearly all everyday biochemistry — buffer prep, gel loading, general protein molecular weight reporting. Monoisotopic mass uses only the most common isotope of each atom (¹²C, ¹H, ¹⁴N, ¹⁶O, ³²S) and is the standard for mass spectrometry, where it corresponds to the sharpest peak in a spectrum. This calculator reports both values simultaneously.

A frequently used shortcut is the 110 Da/residue rule — multiply the number of amino acids by 110 to get a rough protein molecular weight. This approximation is good enough for quick gel-loading estimates or grant-proposal ballpark figures, typically within 5–10% of the true value, but it should never replace a sequence-based calculation when accuracy matters (cloning, mass spec interpretation, molar concentration work).

Formula: Protein MW = Σ(residue masses) + 18.011 Da (water)

Worked Example — 5-Residue Peptide ACDEF

ResidueAmino AcidAvg Mass (Da)
AAlanine71.0788
CCysteine103.1388
DAspartate115.0886
EGlutamate129.1155
FPhenylalanine147.1766

Sum of residues = 71.0788 + 103.1388 + 115.0886 + 129.1155 + 147.1766 = 565.5983 Da

Add water: 565.5983 + 18.011 = 583.61 Da — the final protein molecular weight of peptide ACDEF.

Protein Size in kDa — Converting Daltons to Kilodaltons

1 kDa (kilodalton) equals exactly 1,000 Da (Dalton). Proteins are conventionally reported in kDa rather than Da simply because it produces more convenient, readable numbers — most proteins fall somewhere between 10 kDa and 500 kDa, so "45 kDa" is easier to work with than "45,000 Da." Both units describe the exact same physical quantity: molecular mass.

Here's how protein molecular weight in kDa maps to real biological structures:

CategoryTypical MW RangeExample
Small peptide< 3 kDaInsulin B-chain (~3.4 kDa)
Small protein3–10 kDaUbiquitin (~8.6 kDa)
Typical enzyme20–100 kDaLysozyme (~14.3 kDa), GFP (~27 kDa)
Antibody (IgG)~150 kDaImmunoglobulin G
Large complex500+ kDaRibosome (~2,700 kDa)

Using the 110 Da/residue rule: a 300-amino-acid protein has an estimated protein molecular weight of 300 × 110 = 33,000 Da, or 33 kDa. Use the kDa converter above to move freely between Da, kDa, and MDa, or estimate molecular weight directly from a residue count.

Amino Acid Molecular Weights — Reference Table

This is the complete reference table of average and monoisotopic residue masses for all 20 standard amino acids, used internally by this protein molecular weight calculator and peptide mass calculator.

1-Letter3-LetterNameAvg Residue Mass (Da)Monoisotopic Mass (Da)
AAlaAlanine71.078871.03711
RArgArginine156.1875156.10111
NAsnAsparagine114.1038114.04293
DAspAspartate115.0886115.02694
CCysCysteine103.1388103.00919
EGluGlutamate129.1155129.04259
QGlnGlutamine128.1307128.05858
GGlyGlycine57.051957.02146
HHisHistidine137.1411137.05891
IIleIsoleucine113.1594113.08406
LLeuLeucine113.1594113.08406
KLysLysine128.1741128.09496
MMetMethionine131.1926131.04049
FPhePhenylalanine147.1766147.06841
PProProline97.116797.05276
SSerSerine87.078287.03203
TThrThreonine101.1051101.04768
WTrpTryptophan186.2132186.07931
YTyrTyrosine163.1760163.06333
VValValine99.132699.06841

This amino acid molecular weight calculator reference table also underlies the polypeptide molecular weight and protein mol wt calculator functions above — every residue mass is applied exactly once per occurrence in your sequence.

Molar Extinction Coefficient at 280 nm

The molar extinction coefficient (ε280) predicts how strongly a protein absorbs ultraviolet light at 280 nm, which is the standard wavelength used to measure protein concentration in a spectrophotometer. The Pace method (Pace et al., 1995) calculates it directly from amino acid composition:

ε280 = (nW × 5,500) + (nY × 1,490) + (nC × 125) — measured in M⁻¹cm⁻¹

Tryptophan (W) and tyrosine (Y) absorb strongly at 280 nm because of their aromatic ring side chains; cysteine (C) contributes a small amount, historically attributed to disulfide (cystine) bond formation. Once you know ε280 and the protein molecular weight, you can calculate the concentration of any purified protein solution using the Beer-Lambert law: A = ε × c × l, solved for concentration as c = A / (ε × l).

Limitation: a protein with zero tryptophan, tyrosine, and cysteine residues has an ε280 of exactly 0 — meaning A280 cannot detect it at all, regardless of concentration. This is common in short peptides and certain structural proteins, and is why the calculator correctly returns 0 rather than a false positive value in that case.

Worked Examples

Example 1 — Insulin B-Chain Protein Molecular Weight

Sequence: FVNQHLCGSHLVEALYLVCGERGFFYTPKT (30 residues). Summing all 30 residue masses gives 3,411.94 Da; adding water (18.011 Da) gives a final protein molecular weight of ≈3,429.95 Da, matching the published value of ~3,430 Da.

Example 2 — ACTH 1-10 Peptide Mass Calculator Check

Sequence: SYSMEHFRWG (10 residues). Sum of residue masses = 1,281.41 Da; + water = ≈1,299.4 Da, consistent with the widely published value of ~1,298 Da for this fragment.

Example 3 — Estimating a 300-Residue Protein via the 110 Da Rule

Using the quick estimate: 300 residues × 110 Da/residue = 33,000 Da ≈ 33 kDa. This is a rough figure only — the exact protein molecular weight depends on the actual amino acid composition of the sequence.

Example 4 — Da to kDa Conversion

A calculated protein molecular weight of 45,500 Da converts directly to 45.5 kDa (divide by 1,000) or 0.0455 MDa (divide by 1,000,000).

Example 5 — Extinction Coefficient Calculation

A protein contains 2 tryptophan, 5 tyrosine, and 3 cysteine residues: ε280 = (2 × 5,500) + (5 × 1,490) + (3 × 125) = 11,000 + 7,450 + 375 = 18,825 M⁻¹cm⁻¹. If this protein has a molecular weight of 35,000 Da, the estimated A280 of a 1 mg/mL solution is 18,825 ÷ 35,000 = 0.538.

Example 6 — Protein Concentration from A280 (Beer-Lambert)

Given A280 = 0.85, ε280 = 18,825 M⁻¹cm⁻¹, path length = 1 cm: concentration (M) = 0.85 ÷ 18,825 = 4.515 × 10⁻⁵ M = 45.15 µM. Converting to mass concentration using MW = 35,000 Da: 4.515×10⁻⁵ mol/L × 35,000 g/mol = 1.58 mg/mL (equivalent to 1.58 µg/µL).

Frequently Asked Questions

How do you calculate protein molecular weight? ▾
Protein molecular weight is calculated by summing the average residue mass of every amino acid in the sequence, then adding the mass of one water molecule (18.011 Da) to account for the terminal H and OH groups. For example, the peptide ACDEF has residue masses 71.079 + 103.139 + 115.089 + 129.116 + 147.177 = 565.598 Da, and adding water gives a final protein molecular weight of 583.61 Da. This calculator automates that sum for any sequence you paste in.
What is the average mass of an amino acid residue? ▾
The average mass of an amino acid residue ranges from 57.05 Da for glycine (the smallest) to 186.21 Da for tryptophan (the largest), with a commonly used rule-of-thumb average across all 20 amino acids of approximately 110 Da per residue. This 110 Da/residue approximation is useful for quick estimates, such as estimating protein size from amino acid count, but the exact protein molecular weight calculator above uses the precise mass of each individual residue for an accurate result.
What is the difference between Da and kDa? ▾
Da (Dalton) and kDa (kilodalton) are both units of molecular mass, where 1 kDa equals exactly 1,000 Da. Small molecules and individual amino acids are typically measured in Da, while whole proteins are usually reported in kDa because it produces more convenient numbers — most proteins fall between 10 kDa and 500 kDa. For example, a protein with a molecular weight of 45,500 Da is more commonly written as 45.5 kDa.
How do you estimate protein size from number of amino acids? ▾
A quick estimate of protein molecular weight from sequence length uses the 110 Da/residue rule: multiply the number of amino acids by 110 Da. For example, a 300-amino-acid protein has an estimated molecular weight of 300 × 110 = 33,000 Da, or approximately 33 kDa. This is only a rough approximation — for an accurate protein molecular weight, use the full sequence-based calculator above, which sums the exact mass of each residue in your sequence.
What is monoisotopic mass? ▾
Monoisotopic mass is the molecular mass calculated using only the most abundant naturally occurring isotope of each element (such as carbon-12 and hydrogen-1), rather than the natural isotopic-abundance-weighted average. Monoisotopic mass is used in mass spectrometry because it corresponds to the sharpest, most intense peak in a mass spectrum, while average mass (used for most other biochemistry calculations, like general protein molecular weight reporting) accounts for the natural mix of isotopes. The two values are very close for small peptides but diverge slightly as protein size increases.
How is the molar extinction coefficient calculated? ▾
The molar extinction coefficient at 280 nm (ε280) is calculated using the Pace method: ε280 = (number of tryptophan residues × 5,500) + (number of tyrosine residues × 1,490) + (number of cystine/disulfide pairs × 125), measured in M⁻¹cm⁻¹. Tryptophan and tyrosine absorb ultraviolet light at 280 nm due to their aromatic side chains, which is why ε280 depends only on their count. A protein with zero tryptophan, tyrosine, and cysteine residues has an ε280 of 0, meaning it cannot be reliably quantified by A280 absorbance alone.
Can this protein molecular weight calculator handle peptides as well as full proteins? ▾
Yes. This tool works as both a protein molecular weight calculator and a peptide molecular weight calculator — the underlying math (summing residue masses plus one water molecule) is identical regardless of chain length. Use the Protein/Peptide toggle simply to label your result appropriately; short chains under approximately 50 residues are conventionally called peptides, while longer chains are called proteins or polypeptides.
Why does my protein molecular weight from this calculator differ slightly from a published value? ▾
Small differences (typically under 0.1%) between a calculated protein molecular weight and a published value usually come from post-translational modifications (like glycosylation, phosphorylation, or disulfide bond formation), cleaved signal peptides, or rounding differences in the amino acid mass table used. This calculator computes the theoretical unmodified molecular weight directly from the primary amino acid sequence, which is the standard starting point before accounting for any modifications.

Related Tools

Also see the DNA Molecular Weight Calculator for nucleic acid mass, and the Reverse Complement Calculator for sequence manipulation tools.

⚡ Quick MET / MW Facts
1 kDa= 1,000 Da
Water added18.011 Da
Avg residue rule~110 Da
Trp (W) ε5,500 M⁻¹cm⁻¹
Tyr (Y) ε1,490 M⁻¹cm⁻¹
Cys (C) ε125 M⁻¹cm⁻¹
Smallest AAGly, 57.05 Da
Largest AATrp, 186.21 Da
🔍 Popular Lookups

🔗 Share This Calculator

Share the Protein Molecular Weight Calculator

Data Sources & References

  • Amino acid molecular weights: NIST Chemistry WebBook, amino acid thermochemistry data. webbook.nist.gov
  • Protein molecular weight calculation methodology: Gasteiger et al. (2005), ExPASy: The proteomics server. Nucleic Acids Research 31:3784–3788. DOI: 10.1093/nar/gkg563
  • UniProtKB protein sequence database: uniprot.org
Shahid Ali — Lead Developer, CECOS University Academically Verified
Calculator methods archived with DOI · Last verified: August 2026

Free chemistry, physics, biology & math calculators with step-by-step solutions. Trusted by 1000+ students. Solve any science problem instantly!

Scroll to Top